PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00443.1.g00410.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 109aa    MW: 12249.5 Da    PI: 10.655
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00443.1.g00410.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.24.6e-282373151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krienk+ +qvtf+kRrng+lKKA+ELS LCdaeva+iifs +g+l+e++s
  Zpz_sc00443.1.g00410.1.am.mk 23 KRIENKISQQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFCS 73
                                  79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.031575IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-331574IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-301737IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-271778IPR002100Transcription factor, MADS-box
CDDcd002657.87E-381875No hitNo description
PfamPF003192.7E-242471IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-303752IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-305273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MLPPLRAFLQ TRHHANHGKV ELKRIENKIS QQVTFAKRRN GLLKKAYELS LLCDAEVALI  60
IFSGRGRLFE FCSSSWPAGS LRFTCSKPTV PLKPAVRAGA PDLEMLYLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D5e-181984469Myocyte-specific enhancer factor 2A
3mu6_C5e-181984469Myocyte-specific enhancer factor 2A
3mu6_B5e-181984469Myocyte-specific enhancer factor 2A
3mu6_A5e-181984469Myocyte-specific enhancer factor 2A
1tqe_S7e-181984570Myocyte-specific enhancer factor 2B
1tqe_R7e-181984570Myocyte-specific enhancer factor 2B
1tqe_Q7e-181984570Myocyte-specific enhancer factor 2B
1tqe_P7e-181984570Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693063e-71KF469306.1 Brachypodium distachyon MADS-box transcription factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465643.13e-31hypothetical protein SORBIDRAFT_01g042840
RefseqXP_010532442.12e-31PREDICTED: developmental protein SEPALLATA 3-like isoform X2
SwissprotQ10PZ91e-32MADS1_ORYSJ; MADS-box transcription factor 1
SwissprotA2XDY11e-32MADS1_ORYSI; MADS-box transcription factor 1
TrEMBLW5EAX62e-33W5EAX6_WHEAT; Uncharacterized protein
STRINGGRMZM2G099522_P023e-32(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.37e-33MIKC_MADS family protein